Invitrogen™ Human Hs6st3 (aa 416-471) Control Fragment Recombinant Protein

Product Code. 30212685

Brand: Invitrogen™ RP101543

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111749 (PA5-111749. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

6-O-sulfation enzyme which catalyzes the transfer of sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to position 6 of the N-sulfoglucosamine residue (GlcNS) of heparan sulfate.

Specifications

• Accession Number: Q8IZP7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 266722
• Name: Human Hs6st3 (aa 416-471) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6 OST3; 6-ost-3; DKFZp761K2315; heparan sulfate 6-O-sulfotransferase 3; heparan sulfate 6-O-sulfotransferase 3 b; heparan-sulfate 6-O-sulfotransferase 3; heparan-sulfate 6-O-sulfotransferase 3 pseudogene; heparan-sulfate 6-O-sulfotransferase 3-B; HS 6-OST-3-B; hs6st3; HS6ST-3; hs6st3b; RGD1560050; sb:eu962
• Common Name: Hs6st3
• Gene Symbol: Hs6st3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QQRYHHTKQLEHQRDRQKRREERRLQREHRDHQWPKEDGAAEGTVTEDYNSQVVRW
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining