Invitrogen™ Human HRX (aa 145-251) Control Fragment Recombinant Protein

Product Code. 30208672

Brand: Invitrogen™ RP106079

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

KMT2A is a histone methyltransferase that plays an essential role in early development and hematopoiesis. It is a catalytic subunit of the MLL1/MLL complex, a multiprotein complex that mediates both methylation of 'Lys-4' of histone H3 (H3K4me) complex and acetylation of 'Lys-16' of histone H4 (H4K16ac). In the MLL1/MLL complex, KMT2A specifically mediates H3K4me, a tag for epigenetic transcriptional activation. KMT2A has weak methyltransferase activity by itself, and requires other components of the MLL1/MLL complex to obtain full methyltransferase activity. It has no activity toward histone H3 phosphorylated on 'Thr-3', less activity toward H3 dimethylated on 'Arg-8' or 'Lys-9', and has higher activity toward H3 acetylated on 'Lys-9'. Required for transcriptional activation of HOXA9 and promotes PPP1R15A-induced apoptosis.

Specifications

• Accession Number: Q03164
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4297
• Name: Human HRX (aa 145-251) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6430520K01; ALL1; ALL-1; CDK6/MLL fusion protein; C-terminal cleavage product of 180 kDa; CXXC7; CXXC-type zinc finger protein 7; histone-lysine N-methyltransferase 2 A; histone-lysine N-methyltransferase MLL; HRX; HTRX; HTR x 1; Kmt2a; lysine (K)-specific methyltransferase 2 A; lysine methyltransferase 2 A; lysine N-methyltransferase 2 A; mixed lineage leukemia 1; mKIAA4050; Mll; MLL cleavage product C180; MLL cleavage product N320; MLL/ENL fusion protein; MLL/GAS7; MLL/GAS7 fusion protein; MLL/GMPS fusion protein; MLL/hCDCrel fusion protein; MLL1; MLL1A; MLL-AF4 der(11) fusion protein; MLL-AF9; Myeloid/lymphoid or mixed-lineage leukemia; myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); myeloid/lymphoid or mixed-lineage leukemia 1; myeloid/lymphoid or mixed-lineage leukemia protein 1; N-terminal cleavage product of 320 kDa; p180; p320; rearranged MLL protein; TET1-MLL; trithorax Drosophila; trithorax-like protein; TR x 1; WDSTS; zinc finger protein HRX
• Common Name: HRX
• Gene Symbol: KMT2A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPRSGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKED
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining