Invitrogen™ Human HRI (aa 34-180) Control Fragment Recombinant Protein

Product Code. 30212749

Brand: Invitrogen™ RP91431

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82551 (PA5-82551. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

EIF2AK1 (HRI) is one of 4 kinases that specifically phosphorylate Ser51 of translation initiation factor eIF2-alpha in response to various environmental stresses, leading to a decrease in protein sythesis. In the case of EIF2AK1, signaling is initiated by low levels of heme. The HRI gene is localized to 7p22 where its 3' end slightly overlaps the 3' end of the gene JTV1. The two genes are transcribed from opposite strands and kinase activity is induced by low levels of heme and inhibited by the presence of heme.

Specifications

• Accession Number: Q9BQI3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 27102
• Name: Human HRI (aa 34-180) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: EIF2AK1; eukaryotic translation initiation factor 2 alpha kinase 1; eukaryotic translation initiation factor 2-alpha kinase 1; HCR; he; heme regulated initiation factor 2 alpha kinase; heme sensitive initiation factor 2 A kinase; heme-controlled repressor; Heme-regulated eukaryotic initiation factor eIF-2-alpha kinase; heme-regulated inhibitor; heme-regulated initiation factor 2-alpha kinase; heme-regulated repressor; hemin-sensitive initiation factor 2 A kinase; hemin-sensitive initiation factor 2-alpha kinase; Hri; KIAA1369; PRO1362
• Common Name: HRI
• Gene Symbol: EIF2AK1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PDPEYDESDVPAEIQVLKEPLQQPTFPFAVANQLLLVSLLEHLSHVHEPNPLRSRQVFKLLCQTFIKMGLLSSFTCSDEFSSLRLHHNRAITHLMRSAKERVRQDPCEDISRIQKIRSREVALEAQTSRYLNEFEELAILGKGGYGR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining