Invitrogen™ Human HPS6 (aa 371-454) Control Fragment Recombinant Protein

Product Code. 30203603

Brand: Invitrogen™ RP97152

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83510 (PA5-83510. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This intronless gene encodes a protein that may play a role in organelle biogenesis associated with melanosomes, platelet dense granules, and lysosomes. This protein interacts with Hermansky-Pudlak syndrome 5 protein. Mutations in this gene are associated with Hermansky-Pudlak syndrome type 6.

Specifications

• Accession Number: Q86YV9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79803
• Name: Human HPS6 (aa 371-454) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5330434M19Rik; BLOC2; BLOC2S3; FLJ22501; Hermansky-Pudlak syndrome 6; Hermansky-Pudlak syndrome 6 protein; Hermansky-Pudlak syndrome 6 protein homolog; Hermansky-Pudlak syndrome-6 protein (HPS6); Hps6; HPS6, biogenesis of lysosomal organelles complex 2 subunit 3; Hsp6; MGC20522; RP11-302K17.1; ru; ruby eye; ruby-eye protein; Ruby-eye protein homolog; ruby-eye-like protein
• Common Name: HPS6
• Gene Symbol: Hps6
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TRGNLRLLSALGLFCVGWEAPQGVELPSAKDLVFEEACGYYQRRSLRGAQLTPEELRHSSTFRAPQALASILQGHLPPSALLTM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining