missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30180659

Invitrogen™ Human HPD (aa 119-189) Control Fragment Recombinant Protein

Product Code. 30180659
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30180659

Brand: Invitrogen™ RP97847

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58343 (PA5-58343. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The inhibitor of apoptosis (IAP) family of proteins regulates programmed cell death triggered by various stimuli. All IAPs have at least one baculovirus IAP repeat (BIR) motif that is essential for their anti-apoptotic activity (1-3). Recently, a serine protease has been isolated, which is released from the mitochondria upon induction of apoptosis by apoptotic stimuli. This protein called Omi/HtrA2 is a mitochondrial protein that binds to IAP (4). Like Smac/DIABLO, the mature Omi protein contains a conserved IAP-binding motif (AVPS) at its N terminus. The deregulated expression of Omi in the cytoplasm of mammalian cells induces apoptosis indicating that Omi could participate in the mitochondrial apoptotic pathway.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P32754
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3242
Name Human HPD (aa 119-189) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4 H GLOD3; 4-H HPPDASE; 4 HPPD; 4-HPPD; 4-hydroxyphenylpyruvate dioxygenase; 4-hydroxyphenylpyruvic acid dioxygenase; 4-hydroxyphenylpyruvic acid oxidase; f Alloantigen; F liver antigen; f protein; Fla; Flp; GLOD3; glyoxalase domain containing 3; HPD; Hppd; HPPDASE; Laf; PPD
Common Name HPD
Gene Symbol Hpd
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence REPWVEQDKFGKVKFAVLQTYGDTTHTLVEKMNYIGQFLPGYEAPAFMDPLLPKLPKCSLEMIDHIVGNQP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.