Invitrogen™ Human HP1BP3 (aa 188-285) Control Fragment Recombinant Protein

Product Code. 30211209

Brand: Invitrogen™ RP94182

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55798 (PA5-55798. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HP1BP3 is the component of heterochromatin, may be involved in chromatin structure and function.

Specifications

• Accession Number: Q5SSJ5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 50809
• Name: Human HP1BP3 (aa 188-285) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: heterochromatin protein 1 binding protein 3; heterochromatin protein 1, binding protein 3; heterochromatin protein 1-binding protein 3; Hp1bp3; HP1BP74; HP1-BP74; Protein HP1-BP74
• Common Name: HP1BP3
• Gene Symbol: HP1BP3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IHKYPSLELERRGYLLKQALKRELNRGVIKQVKGKGASGSFVVVQKSRKTPQKSRNRKNRSSAVDPEPQVKLEDVLPLAFTRLCEPKEASYSLIRKYV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining