missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human HOXD3 (aa 356-405) Control Fragment Recombinant Protein

Product Code. 30203397
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30203397

Brand: Invitrogen™ RP107274

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66615 (PA5-66615. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HOXD3 (homeobox D3) belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located at 2q31-2q37 chromosome regions. Deletions that remove the entire HOXD gene cluster or 5' end of this cluster have been associated with severe limb and genital abnormalities. HOXD3 may play a role in the regulation of cell adhesion processes.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P31249
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3232
Name Human HOXD3 (aa 356-405) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias homeo box D3; homeo box D4; homeobox D3; Homeobox gene D3; homeobox protein Hox-4.1; Homeobox protein Hox-4 A; homeobox protein Hox-D3; Homeobox protein MH-19; homeobox protein R6; HO x 1 D; HO x 4; Hox-4.1; Hox-4.1, mouse, homolog of; HO x 4 A; Ho x 4r6; Hox-5.5; HOXD3; Hoxd-3; MGC10470
Common Name HOXD3
Gene Symbol Hoxd3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VYVGGNFVESMAPASGPVFNLGHLSHPSSASVDYSCAAQIPGNHHHGPCD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.