Invitrogen™ Human HOXD10 (aa 58-144) Control Fragment Recombinant Protein

Product Code. 30206543

Brand: Invitrogen™ RP107464

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66806 (PA5-66806. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is a member of the Abd-B homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox D genes located on chromosome 2. The encoded nuclear protein functions as a sequence-specific transcription factor that is expressed in the developing limb buds and is involved in differentiation and limb development. Mutations in this gene have been associated with Wilm's tumor and congenital vertical talus and/or a foot deformity resembling that seen in Charcot-Marie-Tooth disease.

Specifications

• Accession Number: P28358
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3236
• Name: Human HOXD10 (aa 58-144) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI385591; AI874987; d10; homeo box 4 D; homeo box D10; homeo box D10a; homeobox D10; homeobox D10a; homeobox gene D-10; homeobox protein Hox-4.5; Homeobox protein Hox-4 D; homeobox protein Hox-4 E; Homeobox protein Hox-5.3; homeobox protein Hox-C10; Homeobox protein Hox-D10; homeobox protein Hox-D10a; homeobox protein Hox-D11; homeobox protein Hox-D10; HO x 4; Hox-4.4; Hox-4.5; Hox-45; HO x 4 D; HO x 4 E; Hox-5.3; hoxc10; hox-C10; Hoxc10 protein; Hoxd10; HOX-D10; hoxd-10; hoxd10a; hoxd10a protein; z-82
• Common Name: HOXD10
• Gene Symbol: HOXD10
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AKREVNHQNMGMNVHPYIPQVDSWTDPNRSCRIEQPVTQQVPTCSFTTNIKEESNCCMYSDKRNKLISAEVPSYQRLVPESCPVENP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining