missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30195178

Invitrogen™ Human HOXB7 (aa 79-126) Control Fragment Recombinant Protein

Product Code. 30195178
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30195178

Brand: Invitrogen™ RP100938

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The homeobox genes encode transcription factors that regulate developmental processes such as body patterning and organogenesis. The mammalian HOX gene complex consists of 39 genes that are located on 4 linkage groups (clusters), dispersed over 4 chromosomes (HOXA, HOXB, HOXC and HOXD). HOXB7 is expressed in most malignant T-cell lines and CD4-positive peripheral blood cells, and is constitutively expressed in both melanoma primary lesions and cell lines. HOXB7 binds to and transactivates bFGF in melanoma cell lines but SkBr3 breast adenocarcinoma is negative for the expression of both HOXB7 and bFGF genes. HOXB7 may be a key activator of tumor-associated neoangiogenesis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P09629
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3217
Name Human HOXB7 (aa 79-126) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI325018; HHO.C1; homeo box 2 C; homeo box B7; homeo box c1 protein; homeobox B7; homeobox gene B7; homeobox protein HHO.C1; Homeobox protein Hox-2.3; homeobox protein Hox-2 C; Homeobox protein Hox-B7; homeobox protein MH-22 B; Homeobox protein MuB1; homeobox protein R1B; HO x 2; Hox-2.3; Hox-23; HO x 2 C; Ho x 2r1b; Hoxb7; Hoxb-7; R1b
Common Name HOXB7
Gene Symbol Hoxb7
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAAESNFRI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.