Invitrogen™ Human HOXA5 (aa 40-189) Control Fragment Recombinant Protein

Product Code. 30206683

Brand: Invitrogen™ RP102492

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83081 (PA5-83081. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. HOXA5 gene is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. Methylation of this gene may result in the loss of its expression and, since the encoded protein upregulates the tumor suppressor p53, this protein may play an important role in tumorigenesis.

Specifications

• Accession Number: P20719
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3202
• Name: Human HOXA5 (aa 40-189) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: homeo box 1 C; homeo box A5; homeobox A5; homeobox protein Hox-1.3; Homeobox protein Hox-1 C; homeobox protein HOXA5; homeobox protein Hox-A5; homeobox protein M2; HO x 1; HO x 1.3; Hox-1.3; HO x 1 C; Hox-1 C; Hoxa5; Hoxa-5; Unknown (protein for MGC:138007)
• Common Name: HOXA5
• Gene Symbol: HOXA5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MHSGRYGYGYNGMDLSVGRSGSGHFGSGERARSYAASASAAPAEPRYSQPATSTHSPQPDPLPCSAVAPSPGSDSHHGGKNSLSNSSGASADAGSTHISSREGVGTASGAEEDAPASSEQASAQSEPSPAPPAQPQIYPWMRKLHISHDN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining