missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30196299

Invitrogen™ Human HOXA13 (aa 269-319) Control Fragment Recombinant Protein

Product Code. 30196299
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30196299

Brand: Invitrogen™ RP109174

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139894 (PA5-139894. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HoxA13 and HoxD13 also bind to other BMP and TGF-beta/Activin-regulated Smad proteins including Smad1 and Smad2, but not Smad4. In humans and mice, loss of HOXA13 function causes defects in the growth and patterning of the digits and interdigital tissues. Analysis of HoxA13 expression reveals a pattern of localization overlapping with sites of reduced Bmp2 and Bmp7 expression in HoxA13 mutant limbs. HoxA13 regulates Bmp2 and Bmp7 expression, providing a link between HoxA13, its target genes and the specific developmental processes affected by loss of HoxA13 function.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P31271
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3209
Name Human HOXA13 (aa 269-319) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Hd; homeo box 1 J; homeo box A13; homeobox A13; homeobox protein Hox-1.10; Homeobox protein Hox-1 J; homeobox protein HOXA13; homeobox protein Hox-A13; HO x 1; Hox-1.10; HO x 1 J; HOXA13; hypodactyly; RGD1562483; transcription factor HOXA13
Common Name HOXA13
Gene Symbol Hoxa13
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LGLPMESYQPWALPNGWNGQMYCPKEQAQPPHLWKSTLPDVVSHPSDASSY
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.