Invitrogen™ Human HORMAD1 (aa 329-391) Control Fragment Recombinant Protein

Product Code. 30212195

Brand: Invitrogen™ RP94288

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58138 (PA5-58138. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a HORMA domain-containing protein. HORMA domains are involved in chromatin binding and play a role in cell cycle regulation. The encoded protein may play a role in meiosis, and expression of this gene is a potential marker for cancer. A pseudogene of this gene is located on the long arm of chromosome 6. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Specifications

• Accession Number: Q86X24
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84072
• Name: Human HORMAD1 (aa 329-391) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4921522K05Rik; Cancer/testis antigen 46; CT46; HORM1; HORMA domain containing 1; HORMA domain containing protein; HORMA domain-containing protein 1; HORMAD1; Newborn ovary HORMA protein; Nohma; RGD1564960; testis tissue sperm-binding protein Li 86 P
• Common Name: HORMAD1
• Gene Symbol: HORMAD1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MSESKTRSGKVFQNKMANGNQPVKSSKENRKRSQHESGRIVLHHFDSSSQESVPKRRKFSEPK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining