Invitrogen™ Human HOOK3 (aa 192-263) Control Fragment Recombinant Protein

Product Code. 30196184

Brand: Invitrogen™ RP93890

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55172 (PA5-55172. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Hook proteins are cytosolic coiled-coil proteins that contain conserved N-terminal domains, which attach to microtubules, and more divergent C-terminal domains, which mediate binding to organelles. The Drosophila Hook protein is a component of the endocytic compartment.

Specifications

• Accession Number: Q86VS8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84376
• Name: Human HOOK3 (aa 192-263) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5830454D03Rik; AI317159; E330005F07Rik; hHK3; h-hook3; HK3; hook homolog 3; hook homolog 3 (Drosophila); hook microtubule-tethering protein 3; Hook3; mHK3; protein Hook homolog 3
• Common Name: HOOK3
• Gene Symbol: HOOK3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KEEIAQRCHELDMQVAALQEEKSSLLAENQVLMERLNQSDSIEDPNSPAGRRHLQLQTQLEQLQEETFRLEA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining