Invitrogen™ Human HOOK1 (aa 396-494) Control Fragment Recombinant Protein

Product Code. 30205717

Brand: Invitrogen™ RP92294

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53853 (PA5-53853. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the hook family of coiled-coil proteins, which bind to microtubules and organelles through their N- and C-terminal domains, respectively. The encoded protein localizes to discrete punctuate subcellular structures, and interacts with several members of the Rab GTPase family involved in endocytosis. It is thought to link endocytic membrane trafficking to the microtubule cytoskeleton. Several alternatively spliced transcript variants have been identified, but the full-length nature of some of these variants has not been determined.

Specifications

• Accession Number: Q9UJC3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51361
• Name: Human HOOK1 (aa 396-494) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A930033L17Rik; abnormal spermatozoon head shape; azh; hHK1; h-hook1; HK1; hook homolog 1; hook homolog 1 (Drosophila); hook microtubule-tethering protein 1; HOOK1; mHK1; protein Hook homolog 1
• Common Name: HOOK1
• Gene Symbol: HOOK1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AFEMKRLEEKHEALLKEKERLIEQRDTLKETNEELRCSQVQQDHLNQTDASATKSYENLAAEIMPVEYREVFIRLQHENKMLRLQQEGSENERIEELQE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining