Invitrogen™ Human HOMER2 (aa 276-354) Control Fragment Recombinant Protein

Product Code. 30181921

Brand: Invitrogen™ RP98050

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59078 (PA5-59078. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the homer family of dendritic proteins. Members of this family regulate group 1 metabotrophic glutamate receptor function. The encoded protein is a postsynaptic density scaffolding protein. Alternative splicing results in multiple transcript variants. Two related pseudogenes have been identified on chromosome 14.

Specifications

• Accession Number: Q9NSB8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9455
• Name: Human HOMER2 (aa 276-354) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 9330120H11Rik; A VESL-2; ACPD; AW539445; CPD; Cupidin; DFNA68; homer 2; homer homolog 2; homer homolog 2 (Drosophila); homer homolog 3; homer protein homolog 2; homer scaffold protein 2; homer scaffolding protein 2; homer, neuronal immediate early gene, 2; HOMER2; homer-2; VASP/Ena-related gene up-regulated during seizure and LTP 2; Vesl2; Vesl-2
• Common Name: HOMER2
• Gene Symbol: HOMER2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IIPQLMSECEYVSEKLEAAERDNQNLEDKVRSLKTDIEESKYRQRHLKVELKSFLEVLDGKIDDLHDFRRGLSKLGTDN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining