Invitrogen™ Human hnRNP LL (aa 443-508) Control Fragment Recombinant Protein

Product Code. 30207911

Brand: Invitrogen™ RP96109

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61145 (PA5-61145. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HNRNPLL is a master regulator of activation-induced alternative splicing in T cells. In particular, it alters splicing of CD45 (PTPRC), a tyrosine phosphatase essential for T-cell development and activation (Oberdoerffer et al., 2008).

Specifications

• Accession Number: Q8WVV9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 92906
• Name: Human hnRNP LL (aa 443-508) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2510028H02Rik; 2810036L13Rik; AI256697; AI852082; BLOCK24; heterogeneous nuclear ribonucleoprotein L like; heterogeneous nuclear ribonucleoprotein L-like; Hnrnpll; HNRPLL; RGD1305861; SRRF; stromal RNA regulating factor; stromal RNA-regulating factor
• Common Name: hnRNP LL
• Gene Symbol: Hnrnpll
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QASKNIIQPPSCVLHYYNVPLCVTEETFTKLCNDHEVLTFIKYKVFDAKPSAKTLSGLLEWECKTD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining