Invitrogen™ Human hnRNP D (aa 223-294) Control Fragment Recombinant Protein

Product Code. 30204697

Brand: Invitrogen™ RP102523

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82182 (PA5-82182. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are nucleic acid binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind to RNAs. It localizes to both the nucleus and the cytoplasm. This protein is implicated in the regulation of mRNA stability. Alternative splicing of this gene results in four transcript variants.

Specifications

• Accession Number: Q14103
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3184
• Name: Human hnRNP D (aa 223-294) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ARE-binding protein AUFI, type A; Auf1; AUF1A; AU-rich element RNA binding protein 1, 37 kDa; AU-rich element RNA-binding factor 1; AU-rich element RNA-binding protein 1; heterogeneous nuclear ribonucleoprotein D; heterogeneous nuclear ribonucleoprotein D (AU-rich element RNA binding protein 1, 37 kDa); heterogeneous nuclear ribonucleoprotein D0; hnRNP D0; HNRNPD; hnRNPD0; Hnrpd; P37; RNA binding protein p45AUF1
• Common Name: hnRNP D
• Gene Symbol: HNRNPD
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMSKEQYQQQQQWGSRGGFAGRARGRGGDQQSGYGKVS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining