Invitrogen™ Human HNF4G (aa 300-407) Control Fragment Recombinant Protein

Product Code. 30203721

Brand: Invitrogen™ RP89212

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82189 (PA5-82189. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HNF4G is a transcription factor. It has a lower transcription activation potential than HNF4-alpha.

Specifications

• Accession Number: Q14541
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3174
• Name: Human HNF4G (aa 300-407) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: hepatocyte nuclear factor 4 gamma; hepatocyte nuclear factor 4, gamma; hepatocyte nuclear factor 4-gamma; HNF4 gamma; HNF-4 gamma; HNF4-beta; Hnf4g; Hnf4gamma; HNF-4-gamma; NR2A2; NR2A3; Nuclear receptor subfamily 2 group A member 2
• Common Name: HNF4G
• Gene Symbol: HNF4G
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: WQMIEQIQFVKLFGMVKIDNLLQEMLLGGASNDGSHLHHPMHPHLSQDPLTGQTILLGPMSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQASVISHQHLSKQKQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining