Invitrogen™ Human HN1L (aa 95-189) Control Fragment Recombinant Protein

Product Code. 30181814

Brand: Invitrogen™ RP98812

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59774 (PA5-59774. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Hematological and neurological expressed 1-like protein (HN1L) is expressed in liver, kidney, prostate, testis and uterus.

Specifications

• Accession Number: Q9H910
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 90861
• Name: Human HN1L (aa 95-189) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810430B18Rik; AL022629; C16orf34; CRAMP_1 like; D17Ertd441e; hematological and neurological expressed 1-like; hematological and neurological expressed 1-like protein; hematopoietic- and neurologic-expressed sequence 1-like; HN1 like; HN1L; HN1-like protein; Jpt2; Jupiter microtubule associated homolog 2; L11; RGD1305117
• Common Name: HN1L
• Gene Symbol: JPT2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FGSPVTATSRLAHPNKPKDHVFLCEGEEPKSDLKAARSIPAGAEPGEKGSARKAGPAKEQEPMPTVDSHEPRLGPRPRSHNKVLNPPGGKSSISF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining