missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30196440

Invitrogen™ Human HN1 (aa 1-65) Control Fragment Recombinant Protein

Product Code. 30196440
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30196440

Brand: Invitrogen™ RP101959

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HN1 (hematopoietic- and neurologic-expressed sequence 1) is a highly conserved protein that is expressed in developing and regenerating tissues. Overexpression of HN1 has been reported in various tumors like glioma and breast cancer. Hn1 has also been reported as a marker for human ovarian carcinoma and can distinguish epithelial ovarian carcinoma cells from normal ovarian surface epithelial cells. This collective information suggests that HN1 is involved in processes associated with cell proliferation, repair and/or growth.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9UK76
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51155
Name Human HN1 (aa 1-65) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Androgen-regulated protein 2; ARM2; hematological and neurological expressed 1; hematological and neurological expressed 1 protein; hematological and neurological expressed sequence 1; HN1; HN1A; Jpt1; Jupiter microtubule associated homolog 1; Jupiter microtubule associated homolog 1, N-terminally processed
Common Name HN1
Gene Symbol JPT1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MTTTTTFKGVDPNSRNSSRVLRPPGGGSNFSLGFDEPTEQPVRKNKMASNIFGTPEENQASWAKS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.