Invitrogen™ Human HMX2 (aa 211-273) Control Fragment Recombinant Protein

Product Code. 30182541

Brand: Invitrogen™ RP99973

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60346 (PA5-60346. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Homeobox genes represent a class of transcription factors that play key roles in the regulation of embryogenesis and development. Here we report the identification of a homeobox-containing gene family that is highly conserved at both the nucleotide and amino acid levels in a diverse number of species. These species encompass both vertebrate and invertebrate phylogenies, ranging from Homo sapiens to Drosophila melanogaster.

Specifications

• Accession Number: A2RU54
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3167
• Name: Human HMX2 (aa 211-273) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: H6 family homeobox 2; H6 homeo box 2; H6 homeobox 2; H6L; HMX2; homeo box (H6 family) 2; homeobox protein H6 family member 2; Homeobox protein HMX2; homeobox protein Nkx-5.2; MGC32455; NK-related homeobox; Nkx-5.2; Nkx5-2
• Common Name: HMX2
• Gene Symbol: HMX2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ELEAANMAHASAQTLVSMPLVFRDSSLLRVPVPRSLAFPAPLYYPGSNLSALPLYNLYNKLDY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining