Invitrogen™ Human HMGXB4 (aa 414-505) Control Fragment Recombinant Protein

Product Code. 30209061

Brand: Invitrogen™ RP109581

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139948 (PA5-139948. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

High mobility group (HMG) proteins are nonhistone chromosomal proteins.

Specifications

• Accession Number: Q9UGU5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10042
• Name: Human HMGXB4 (aa 414-505) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: high mobility group protein 2-like 1; high-mobility group protein 2-like 1; HMG box domain containing 4; HMG box-containing protein 4; HMG domain-containing protein 4; HMG2L1; HMGBCG; HMG-box containing 4; HMGXB4; Protein HMGBCG; Protein THC211630; THC211630
• Common Name: HMGXB4
• Gene Symbol: HMGXB4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YQVFCKEYRVTIVADHPGIDFGELSKKLAEVWKQLPEKDKLIWKQKAQYLQHKQNKAEATTVKRKASSSEGSMKVKASSVGVLSPQKKSPPT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining