Invitrogen™ Human HMGCS2 (aa 11-80) Control Fragment Recombinant Protein

Product Code. 30206912

Brand: Invitrogen™ RP94209

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55620 (PA5-55620. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene belongs to the HMG-CoA synthase family. It is a mitochondrial enzyme that catalyzes the first reaction of ketogenesis, a metabolic pathway that provides lipid-derived energy for various organs during times of carbohydrate deprivation, such as fasting. Mutations in this gene are associated with HMG-CoA synthase deficiency. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: P54868
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3158
• Name: Human HMGCS2 (aa 11-80) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1300002P16; 3-hydroxy-3-methylglutary-Coenzyme A synthase 2; 3-hydroxy-3-methylglutaryl coenzyme A synthase; 3-hydroxy-3-methylglutaryl-CoA synthase 2; 3-hydroxy-3-methylglutaryl-CoA synthase 2 (mitochondrial); 3-hydroxy-3-methylglutaryl-coenzyme A synthase; 3-hydroxy-3-methylglutaryl-Coenzyme A synthase 2; 3-hydroxy-3-methylglutaryl-Coenzyme A synthase 2 (mitochondrial); hmgCoA; HMG-CoA synthase; Hmgcs1; Hmgcs2; hydroxymethylglutaryl-CoA synthase 2; hydroxymethylglutaryl-CoA synthase, mitochondrial; mHS; Mt3h3mg; testicular tissue protein Li 88
• Common Name: HMGCS2
• Gene Symbol: HMGCS2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ILQLTRAVQETSLTPARLLPVAHQRFSTASAVPLAKTDTWPKDVGILALEVYFPAQYVDQTDLEKYNNVE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining