Invitrogen™ Human HM13 (aa 130-209) Control Fragment Recombinant Protein

Product Code. 30199866

Brand: Invitrogen™ RP91119

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60919 (PA5-60919. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Catalyzes intramembrane proteolysis of some signal peptides after they have been cleaved from a preprotein, resulting in the release of the fragment from the ER membrane into the cytoplasm. Required to generate lymphocyte cell surface (HLA-E) epitopes derived from MHC class I signal peptides. May play a role in graft rejection. May be necessary for the removal of the signal peptide that remains attached to the hepatitis C virus core protein after the initial proteolytic processing of the polyprotein. Involved in the intramembrane cleavage of the integral membrane protein PSEN1. Cleaves the integral membrane protein XBP1 isoform 1 in a DERL1/RNF139- dependent manner.

Specifications

• Accession Number: Q8TCT9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 81502
• Name: Human HM13 (aa 130-209) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1200006O09Rik; 4930443L17Rik; 5031424B04Rik; AV020344; cb228; H13; H-13; hIMP1; histocompatibility (minor) 13; histocompatibility 13; histocompatibility minor 13; HM13; hm13 protein; IMP1; IMP-1; IMPAS; IMPAS-1; intramembrane aspartyl protease; intramembrane protease 1; minor histocompatibility antigen 13; minor histocompatibility antigen H13; MSTP086; presenilin-like aspartyl protease; presenilin-like protein 3; PSENL3; PSL3; Signal peptide peptidase; signal peptide peptidase beta; signal peptide peptidase like 1; SPP; SPPL1; Unknown (protein for MGC:134054); wu:fc11a06; zgc:56660; zgc:86862
• Common Name: HM13
• Gene Symbol: HM13
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PASFPNRQYQLLFTQGSGENKEEIINYEFDTKDLVCLGLSSIVGVWYLLRKHWIANNLFGLAFSLNGVELLHLNNVSTGC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining