Invitrogen™ Human HLTF (aa 164-300) Control Fragment Recombinant Protein

Product Code. 30193735

Brand: Invitrogen™ RP91601

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82525 (PA5-82525. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the SWI/SNF family. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein contains a RING finger DNA binding motif. Two transcript variants encoding the same protein have been found for this gene. However, use of an alternative translation start site produces an isoform that is truncated at the N-terminus compared to the full-length protein.

Specifications

• Accession Number: Q14527
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6596
• Name: Human HLTF (aa 164-300) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AF010600; BC057116; DNA-binding protein/plasminogen activator inhibitor 1 regulator; DNA-binding protein/plasminogen activator inhibitor-1 regulator; helicase like transcription factor; helicase-like transcription factor; HIP116; HIP116A; HLTF; HLTF1; mem; P113; RING finger protein 80; RING-type E3 ubiquitin transferase HLTF; RNF80; Smarca3; Snf2l3; SNF2-like 3; Sucrose nonfermenting protein 2-like 3; sucrose nonfermenting-like 3; SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 3; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3; TNF-response element-binding protein; ZBU1
• Common Name: HLTF
• Gene Symbol: HLTF
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LKKHGFKLGPAPKTLGFNLESGWGSGRAGPSYSMPVHAAVQMTTEQLKTEFDKLFEDLKEDDKTHEMEPAEAIETPLLPHQKQALAWMVSRENSKELPPFWEQRNDLYYNTITNFSEKDRPENVHGGILADDMGLGK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining