Invitrogen™ Human HLA-DQB2 (aa 86-133) Control Fragment Recombinant Protein

Product Code. 30205668

Brand: Invitrogen™ RP109326

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (52%), Rat (52%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140258 (PA5-140258. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HLA-DQB2 belongs to the family of HLA class II beta chain paralogs. Class II molecules are heterodimers consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. They play a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). Polymorphisms in the alpha and beta chains specify the peptide binding specificity, and typing for these polymorphisms is routinely done for bone marrow transplantation. However this gene, HLA-DQB2, is not routinely typed, as it is not thought to have an effect on transplantation. There is conflicting evidence in the literature and public sequence databases for the protein-coding capacity of HLA-DQB2. HLA and MHC antibodies play a significant role in Immunopeptidomics, facilitating the identification and characterization of neoantigens through high-performance liquid chromatography coupled to tandem Mass Spectrometry.

Specifications

• Accession Number: P05538
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3120
• Name: Human HLA-DQB2 (aa 86-133) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: DV19.1 (major histocompatibility complex, class II, DQ beta 2 (HLA-DXB)); HLA class II histocompatibility antigen, DQ beta 2 chain; HLA class II histocompatibility antigen, DX beta chain; HLA-DQB1; HLA-DQB2; HLA-DXB; major histocompatibility complex, class II, DQ beta 1; major histocompatibility complex, class II, DQ beta 2; MHC class II antigen DQB2
• Common Name: HLA-DQB2
• Gene Symbol: HLA-DQB2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GRSIEDWNNYKDFLEQERAAVDKVCRHNYEAELRTTLQRQVEPTVTIS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining