Invitrogen™ Human HLA-DQB1 Control Fragment Recombinant Protein

Product Code. 30211901

Brand: Invitrogen™ RP90524

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82487 (PA5-82487. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HLA-DRB1 belongs to the HLA class II beta chain paralogs. The class II molecule is a heterodimer consisting of an alpha (DRA) and a beta chain (DRB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa. It is encoded by 6 exons. Exon one encodes the leader peptide; exons 2 and 3 encode the two extracellular domains; exon 4 encodes the transmembrane domain; and exon 5 encodes the cytoplasmic tail. Within the DR molecule the beta chain contains all the polymorphisms specifying the peptide binding specificities. Hundreds of DRB1 alleles have been described and typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. DRB1 is expressed at a level five times higher than its paralogs DRB3, DRB4 and DRB5. DRB1 is present in all individuals. Allelic variants of DRB1 are linked with either none or one of the genes DRB3, DRB4 and DRB5. There are 4 related pseudogenes: DRB2, DRB6, DRB7, DRB8 and DRB9. HLA and MHC antibodies play a significant role in Immunopeptidomics, facilitating the identification and characterization of neoantigens through high-performance liquid chromatography coupled to tandem Mass Spectrometry.

Specifications

• Accession Number: P01920
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3119
• Name: Human HLA-DQB1 Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: CELIAC1; DQ beta 1; HLA class II antigen; HLA class II histocompatibility antigen, DQ beta 1 chain; HLA-DQB; HLA-DQB1; HLA-DRB1; IDDM1; lymphocyte antigen; major histocompatibility complex, class II, DQ beta 1; MHC class II antigen DQB1; MHC class II antigen HLA-DQ-beta-1; MHC class II DQ beta chain; MHC class II HLA-DQ beta glycoprotein; MHC class2 antigen; MHC DQ beta
• Common Name: HLA-DQB1
• Gene Symbol: HLA-DQB1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RPDAEYWNSQKEVLEGTRAELDTVCRHNYEVAFRGILQRRVEPTVTISPSRTEALNHHNLLVCSVT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining