missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human HIPPI (aa 23-112) Control Fragment Recombinant Protein

Product Code. 30210684
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210684

Brand: Invitrogen™ RP96303

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83275 (PA5-83275. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HIPPI is required for the formation of cilia. Plays an indirect role in sonic hedgehog signaling, cilia being required for all activity of the hedgehog pathway. Has pro-apoptotic function via its interaction with HIP1, leading to recruit caspase-8 (CASP8) and trigger apoptosis. Has the ability to bind DNA sequence motif 5'-AAAGACATG-3' present in the promoter of caspase genes such as CASP1, CASP8 and CASP10, suggesting that it may act as a transcription regulator; however the relevance of such function remains unclear.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NWB7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55081
Name Human HIPPI (aa 23-112) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4833420A15Rik; dermal papilla-derived protein 8; DERP8; Esrrbl1; estrogen-related receptor beta like 1; estrogen-related receptor beta-like protein 1; FLJ10147; HIP1 protein interactor; HIP1-interacting protein; Hippi; huntingtin interacting protein-1 interacting protein; huntingtin-interacting protein-1 protein interactor; IFT57; intraflagellar transport 57; intraflagellar transport 57 homolog; intraflagellar transport protein 57 homolog; MHS4R2; Vestrogen-related receptor beta like 1
Common Name HIPPI
Gene Symbol IFT57
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EGTGEVVLERGPGAAYHMFVVMEDLVEKLKLLRYEEEFLRKSNLKAPSRHYFALPTNPGEQFYMFCTLAAWLINKAGRPFEQPQEYDDPN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.