Invitrogen™ Human HIP2 (aa 87-196) Control Fragment Recombinant Protein

Artikelnummer.	Quantity	unitSize
30207208	100 μL	100µL

Artikelnummer. 30207208 Leverandør Invitrogen™ Leverandørnr. RP102065

Beskrivelse

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83038 (PA5-83038. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro, in the presence or in the absence of BRCA1-BARD1 E3 ubiquitin-protein ligase complex, catalyzes the synthesis of 'Lys-48'-linked polyubiquitin chains. Does not transfer ubiquitin directly to but elongates monoubiquitinated substrate protein. Mediates the selective degradation of short-lived and abnormal proteins, such as the endoplasmic reticulum-associated degradation (ERAD) of misfolded lumenal proteins. Ubiquitinates huntingtin. May mediate foam cell formation by the suppression of apoptosis of lipid-bearing macrophages through ubiquitination and subsequence degradation of p53/TP53. Proposed to be involved in ubiquitination and proteolytic processing of NF-kappa-B; in vitro supports ubiquitination of NFKB1. In case of infection by cytomegaloviruses may be involved in the US11-dependent degradation of MHC class I heavy chains following their export from the ER to the cytosol. In case of viral infections may be involved in the HPV E7 protein-dependent degradation of RB1.

Tekniske data

• Accession Number: P61086
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3093
• Name: Human HIP2 (aa 87-196) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AW492011; D5Ertd601e; DKFZp564C1216; DKFZp686J24237; E2 ubiquitin-conjugating enzyme K; E2(25 K); E2-25 k; HIP2; HIP-2; huntingtin interacting protein 2; huntingtin-interacting protein 2; HYPG; LIG; UBC1; UBE2K; Ubiquitin carrier protein; ubiquitin conjugating enzyme E2 K; ubiquitin conjugating enzyme E2K; ubiquitin-conjugating enzyme E2 K; Ubiquitin-conjugating enzyme E2(25 K); ubiquitin-conjugating enzyme E2-25 KDA; ubiquitin-conjugating enzyme E2-25 K; ubiquitin-conjugating enzyme E2K; ubiquitin-conjugating enzyme E2K (UBC1 homolog, yeast); ubiquitin-protein ligase
• Common Name: HIP2
• Gene Symbol: UBE2K
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQTARLWAHVYAGAPVSSPEYTKKIENLCAMGFDRNAVIVALSSKSWDVETATEL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining