Invitrogen™ Human HIP (aa 105-174) Control Fragment Recombinant Protein

Product Code. 30182407

Brand: Invitrogen™ RP99511

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83854 (PA5-83854. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is an adaptor protein that mediates the association of the heat shock proteins HSP70 and HSP90. This protein has been shown to be involved in the assembly process of glucocorticoid receptor, which requires the assistance of multiple molecular chaperones. The expression of this gene is reported to be downregulated in colorectal carcinoma tissue suggesting that is a candidate tumor suppressor gene.

Specifications

• Accession Number: P50502
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6767
• Name: Human HIP (aa 105-174) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110007I03Rik; 3110002K08Rik; AAG2; aging-associated protein 2; AW555194; FAM10A1; FAM10A4; heat shock 70 kD protein binding protein; hedgehog interacting protein; hedgehog-interacting protein; HHIP; HIP; HOP; Hsc70-interacting protein; Hsp70 interacting protein; Hsp70-interacting protein; HSPABP; HSPABP1; hypothetical protein; p48; PRO0786; Progesterone receptor-associated p48 protein; Protein FAM10A1; Protein ST13 homolog; putative tumor suppressor ST13; RCJMB04_6h13; Renal carcinoma antigen NY-REN-33; SNC6; ST13; ST13 Hsp70 interacting protein; ST13, Hsp70 interacting protein; ST13P5; suppression of tumorigenicity 13; suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein); suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) pseudogene 5; suppression of tumorigenicity 13 (colon carcinoma) Hsp70-interacting protein; suppression of tumorigenicity 13 protein; testis secretory sperm-binding protein Li 233 m; UNQ5825/PRO19644
• Common Name: HIP
• Gene Symbol: St13
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EITEEMMDQANDKKVAAIEALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining