Invitrogen™ Human HINT1 (aa 55-116) Control Fragment Recombinant Protein

Product Code. 30212832

Brand: Invitrogen™ RP96928

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60760 (PA5-60760. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Histidine triad nucleotide-binding protein 1 (HINT1) is a member of the histidine triad (HIT) protein family, a group of small nucleotide-binding and -hydrolyzing proteins. HINT1 interacts with several diverse proteins and has been suggested to have tumor suppressive activities. HINT1 catalyzes the hydrolysis of adenosine 5'-monophoramidate substrates such as AMP-morpholidate, but its enzymatic function does not appear to play a role in its tumor suppression. Recent experiments demonstrate that HINT1 forms a complex with POSH and JNK in vivo, inhibiting AP-1 activity and the phosphorylation of c-Jun, and this action could contribute to the tumor suppressor activity of HINT1. Other studies raise the possibility of HINT1 as a candidate gene for schizophrenia.

Specifications

• Accession Number: P49773
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3094
• Name: Human HINT1 (aa 55-116) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 17 kDa inhibitor of protein kinase C; AA673479; Adenosine 5'-monophosphoramidase; FLJ30414; FLJ32340; HINT; Hint1; histidine triad nucleotide binding protein 1; histidine triad nucleotide-binding protein 1; Ipk1; NMAN; PKC inhibitor/ interacting protein; Pkci; PKCI1; PKCI-1; Prkci; PRKCNH1; protein kinase C inhibitor 1; protein kinase C, iota; protein kinase C-interacting protein 1
• Common Name: HINT1
• Gene Symbol: Hint1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining