Invitrogen™ Human HIF3A (aa 411-486) Control Fragment Recombinant Protein

Product Code. 30181775

Brand: Invitrogen™ RP98477

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cell growth and viability is compromised by oxygen deprivation (hypoxia). Hypoxia-inducible factors, including HIF-1 alpha, HIF-1 beta (also designated Arnt 1), EPAS-1 (also designated HIF-2 alpha) and HIF-3 alpha, induce glycolysis, erythropoiesis and angiogenesis in order to restore oxygen homeostasis. Hypoxia-inducible factors are members of the Per-Arnt-Sim (PAS) domain transcription factor family. In response to hypoxia, HIF-1 alpha is upregulated and forms a heterodimer with Arnt 1 to form the HIF-1 complex. The HIF-1 complex recognizes and binds to the hypoxia responsive element (HRE) of hypoxia-inducible genes, thereby activating transcription.

Specifications

• Accession Number: Q9Y2N7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 64344
• Name: Human HIF3A (aa 411-486) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Basic-helix-loop-helix-PAS protein MOP7; BHLHE17; Class E basic helix-loop-helix protein 17; HIF-3 alpha; HIF3 alpha 1; HIF3A; HIF-3 A; HIF-3-alpha; HIF3-alpha; HIF3-alpha-1; hypoxia inducible factor 3 alpha; hypoxia inducible factor 3 alpha subunit; hypoxia inducible factor 3, alpha subunit; hypoxia inducible factor 3 A; hypoxia inducible factor three alpha; hypoxia-inducible factor 3 alpha; hypoxia-inducible factor 3-alpha; Inhibitory PAS domain protein; IPAS; Member of PAS protein 7; Mop7; Neonatal and embryonic PAS protein; NEPAS; PAS domain-containing protein 7; PASD7
• Common Name: HIF3A
• Gene Symbol: HIF3A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SPDLRRLLGPILDGASVAATPSTPLATRHPQSPLSADLPDELPVGTENVHRLFTSGKDTEAVETDLDIAQDADALD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining