missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human HIF-2 alpha (aa 538-619) Control Fragment Recombinant Protein

Product Code. 30200418
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200418

Brand: Invitrogen™ RP108555

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HIF-2 alpha (Epas1) is a transcription factor involved in the induction of genes regulated by oxygen. HIF-2 alpha contains a basic-helix-loop-helix domain protein dimerization domain as well as a domain found in proteins in signal transduction pathways which respond to oxygen levels. It also regulates the vascular endothelial growth factor (VEGF) expression and seems to be implicated in the development of blood vessels and the tubular system of the lungs. Mutations in this gene are associated with erythrocytosis familial type 4.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q99814
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2034
Name Human HIF-2 alpha (aa 538-619) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias basic-helix-loop-helix-PAS protein MOP2; bHLHe73; Class E basic helix-loop-helix protein 73; ECYT4; endothelial PAS domain protein 1; endothelial PAS domain protein 1 b; endothelial PAS domain-containing protein 1; endothelial PAS domain-containing protein 1 b; EPAS; Epas1; EPAS-1; epas1b; Hif like protein; HIF1 alpha-like factor; HIF-1-alpha-like factor; HIF-1 alpha-like factor; HIF1alpha-like factor; HIF2 alpha; HIF-2 alpha; HIF2A; hif-2 A; hif-2 ab; HIF-2 alpha; HIF-2-alpha; HIF2-alpha; HIF-related factor; HLF; HLF (HIF1alpha-like factor); HRF; hypoxia inducible factor 2 alpha; hypoxia inducible factor 2, alpha subunit; hypoxia inducible factor 2 A; hypoxia inducible transcription factor 2 alpha; hypoxia-inducible factor 2 alpha; hypoxia-inducible factor 2-alpha; Member of PAS protein 2; mHLF; MOP2; PAS domain-containing protein 2; PASD2; wu:fq36f01
Common Name HIF-2 alpha
Gene Symbol EPAS1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EDFQLSPICPEERLLAENPQSTPQHCFSAMTNIFQPLAPVAPHSPFLLDKFQQQLESKKTEPEHRPMSSIFFDAGSKASLPP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.