Invitrogen™ Human HHATL (aa 150-250) Control Fragment Recombinant Protein

Product Code. 30193738

Brand: Invitrogen™ RP90837

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53748 (PA5-53748. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HHATL (Hedgehog Acyltransferase-Like) is a gene that codes for a protein involved in the regulation of Hedgehog signaling pathways. HHATL is located on chromosome 7q36.3. Structurally, the protein encoded by this gene is characterized by an acyltransferase domain, which plays a crucial role in the N-palmitoylation of the Sonic Hedgehog (Shh) protein, a process essential for its proper signaling activity and distribution. Functionally, HHATL has been implicated in various biological processes, including amelioration of endoplasmic reticulum stress through autophagy. The gene is expressed in several tissues, with notable high expression in the heart, suggesting a potential role in cardiac development and function. Dysfunction in HHATL could lead to anomalies in Hedgehog signaling, impacting various developmental and cellular processes.

Specifications

• Accession Number: Q9HCP6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57467
• Name: Human HHATL (aa 150-250) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110011D13Rik; C3orf3; Glycerol uptake/transporter homolog; GUP1; GUP1 glycerol uptake/transporter homolog; Gup1, glycerol uptake/transporter homolog; hedgehog acyltransferase-like; hedgehog acyltransferase-like protein; HHATL; KIAA1173; MBOAT3; membrane bound O-acyltransferase domain containing 3; MSTP002; OACT3; Protein-cysteine N-palmitoyltransferase HHAT-like protein; RGD1311911
• Common Name: HHATL
• Gene Symbol: HHATL
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ASFKMDPLISWQSGFVTGTFDLQEVLFHGGSSFTVLRCTSFALESCAHPDRHYSLADLLKYNFYLPFFFFGPIMTFDRFHAQVSQVEPVRREGELWHIRAQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining