Invitrogen™ Human HGK (aa 619-737) Control Fragment Recombinant Protein

Product Code. 30202452

Brand: Invitrogen™ RP89770

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82354 (PA5-82354. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MAP4K4 (HGK) is a serine/threonine kinase which plays an important role in stress-activated MAPK core signaling pathways, the response to environmental stress and cytokines such as TNF-alpha. It appears to act upstream of the JUN N-terminal pathway. This protein is thought to interact with the SH3 domain of the adapter proteins Nck. HGK binds, via its CNH regulatory domain, to the N-terminal region of SPG3A. Expression appears to be ubiquitous, expressed in all tissue types examined. Isoform 5 appears to be more abundant in the brain, and isoform 4 is predominant in the liver, skeletal muscle and placenta.

Specifications

• Accession Number: O95819
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9448
• Name: Human HGK (aa 619-737) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 9430080K19Rik; AU043147; AU045934; AW046177; epididymis secretory protein Li 31; FLH21957; FLJ10410; FLJ20373; FLJ90111; HEL-S-31; hepatocyte progenitor kinase-like/germinal center kinase-like kinase; HGK; HPK/GCK-like kinase HGK; KIAA0687; Map4k4; MAPK/ERK kinase kinase kinase 4; MEK kinase kinase 4; MEKKK 4; MEKKK4; mitogen activated protein kinase kinase kinase kinase 4; mitogen-activated protein kinase kinase kinase kinase 4; NCK interacting kinase; nck-interacting kinase; NIK; Ste20 group protein kinase HGK
• Common Name: HGK
• Gene Symbol: MAP4K4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AEPQVQWSHLASLKNNVSPVSRSHSFSDPSPKFAHHHLRSQDPCPPSRSEVLSQSSDSKSEAPDPTQKAWSRSDSDEVPPRVPVRTTSRSPVLSRRDSPLQGSGQQNSQAGQRNSTSSI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining