Invitrogen™ Human HFM1 (aa 1187-1273) Control Fragment Recombinant Protein

Product Code. 30203335

Brand: Invitrogen™ RP102643

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83256 (PA5-83256. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is thought to be an ATP-dependent DNA helicase and is expressed mainly in germ-line cells. Defects in this gene are a cause of premature ovarian failure 9 (POF9).

Specifications

• Accession Number: A2PYH4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 164045
• Name: Human HFM1 (aa 1187-1273) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A330009G12Rik; Gm1046; helicase; helicase-like protein HFM1; Hfm1; HFM1, ATP dependent DNA helicase homolog; HFM1, ATP-dependent DNA helicase homolog; HFM1, ATP-dependent DNA helicase homolog (S. cerevisiae); Mer3; POF9; probable ATP-dependent DNA helicase HFM1; RP11-539G11.1; SEC3D1; SEC63 domain containing 1; SEC63 domain-containing protein 1; SEC63D1; Si-11; Si-11-6
• Common Name: HFM1
• Gene Symbol: HFM1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SSVPPVKRLKIQMNKSQSVDLKEFGFTPKPSLPSISRSEYLNISELPIMEQWDQPEIYGKVRQEPSEYQDKEVLNVNFELGNEVWDD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining