missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30212826

Invitrogen™ Human HEY1 (aa 157-217) Control Fragment Recombinant Protein

Product Code. 30212826
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30212826

Brand: Invitrogen™ RP95672

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111421 (PA5-111421. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Hairy/enhancer-of-split related with YRPW motif protein 1 belongs to the HEY family and is a Notch Signaling Pathway Protein. It contains one basic helix-loop-helix (bHLH) domain and one Orange domain. It is a downstream effector of Notch signaling which may be required for cardiovascular development. It acts as transcriptional repressor which binds preferentially to the canonical E box sequence 5'-CACGTG-3'. It represses transcription by the cardiac transcriptional activators GATA4 and GATA6. Hey1 is also reported to be expressed during development of the nervous system.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9Y5J3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23462
Name Human HEY1 (aa 157-217) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI316788; AI414254; basic helix-loop-helix protein OAF1; basic helix-loop-helix transcription factor; BC8; bHLH protein Hesr-1/Hey1; bHLHb31; cardiovascular basic helix-loop-helix factor 2; cardiovascular helix-loop-helix factor 2; CHF2; CHF-2; class B basic helix-loop-helix protein 31; Hairy and enhancer of split-related protein 1; Hairy/E(spl)-related with YRPW motif 1; hairy/enhancer-of-split related with YRPW motif 1; hairy/enhancer-of-split related with YRPW motif protein 1; hairy-related transcription factor 1; Herp1; Herp2; hes related family bHLH transcription factor with YRPW motif 1; Hesr1; HESR-1; hes-related family bHLH transcription factor with YRPW motif 1; HES-related repressor protein 1; HES-related repressor protein 2; HEY1; hey1 protein; hHRT1; HRT1; HRT-1; id:ibd1292; MGC1274; mHRT1; OAF1; zgc:110572
Common Name HEY1
Gene Symbol HEY1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.