Invitrogen™ Human HEXIM2 (aa 212-286) Control Fragment Recombinant Protein

Product Code. 30208452

Brand: Invitrogen™ RP93398

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54764 (PA5-54764. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Transcriptional regulator which functions as a general RNA polymerase II transcription inhibitor. In cooperation with 7SK snRNA sequesters P-TEFb in a large inactive 7SK snRNP complex preventing RNA polymerase II phosphorylation and subsequent transcriptional elongation.

Specifications

• Accession Number: Q96MH2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 124790
• Name: Human HEXIM2 (aa 212-286) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4933402L21Rik; hexamethylene bisacetamide inducible 2; hexamethylene bis-acetamide inducible 2; hexamethylene bis-acetamide-inducible protein 2; hexamethylene-bis-acetamide-inducible transcript 2; hexamthylene bis-acetamide inducible 2; HEXIM2; L3; MAQ1 paralog; protein HEXIM2; RGD1311635
• Common Name: HEXIM2
• Gene Symbol: HEXIM2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ELVRDYLELEKRLSQAEEETRRLQQLQACTGQQSCRQVEELAAEVQRLRTENQRLRQENQMWNREGCRCDEEPGT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining