Invitrogen™ Human HEXDC (aa 252-340) Control Fragment Recombinant Protein

Product Code. 30195026

Brand: Invitrogen™ RP93404

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54780 (PA5-54780. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HEXD (Hexosaminidase D) is a Protein Coding gene. Among its related pathways are Other glycan degradation and Metabolism.

Specifications

• Accession Number: Q8WVB3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 284004
• Name: Human HEXDC (aa 252-340) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: BC069960; beta-hexosaminidase D; Beta-N-acetylhexosaminidase; HEXD; HEXDC; hexosaminidase (glycosyl hydrolase family 20, catalytic domain) containing; hexosaminidase D; hexosaminidase D, cytosolic; hexosaminidase domain-containing protein; N-acetyl-beta-galactosaminidase
• Common Name: HEXDC
• Gene Symbol: HEXDC
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ASAFKGATGPSQAVPPVEHHLRNHVQWLQVAGSGPTDSLQGIILTGWQRYDHYSVLCELLPAGVPSLAACLQLLLRGGFDEDVKAKVEN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining