Invitrogen™ Human MBD3L1 (aa 82-152) Control Fragment Recombinant Protein

Product Code. 30180797

Brand: Invitrogen™ RP99180

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (41%), Rat (41%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61306 (PA5-61306. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein that is related to methyl-CpG-binding proteins but lacks the methyl-CpG binding domain. The protein is localized to discrete areas in the nucleus, and expression appears to be restricted to round spermatids, suggesting that the protein plays a role in the postmeiotic stages of male germ cell development.

Specifications

• Accession Number: Q8WWY6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 85509
• Name: Human MBD3L1 (aa 82-152) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700070G05Rik; 1700095H13Rik; LOC100717039; Mbd3l; MBD3L1; MBD3-like protein 1; methyl-CpG binding domain protein 3 like 1; methyl-CpG binding domain protein 3-like 1; methyl-CpG-binding domain protein 3-like 1; Unknown (protein for MGC:137086)
• Common Name: MBD3L1
• Gene Symbol: MBD3L1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ELSSTLDLANTLQKLVPSYTGGSLLEDLASGLEHSCPMPHLACSSDAVEIIPAEGVGISQLLCKQFLVTEE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining