missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30211315

Invitrogen™ Human HERC5 (aa 640-735) Control Fragment Recombinant Protein

Product Code. 30211315
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211315

Brand: Invitrogen™ RP96656

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (44%), Rat (44%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60556 (PA5-60556. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HERC5 (E3 ISG15 - protein ligase HERC5) is a major E3 ligase for ISG15 conjugation. It acts a positive regulator of innate antiviral response in cells induced by interferon. HERC5 functions as a part of the ISGylation machinery that recognizes target protein in a broad and relatively non-specific manner. It catalyzes ISGylation of IRF3 - which results in sustained activation, it attenuates IRF3-PIN1 interaction - which antagonizes IFR3 ubiquitination and degradation, and boosts the antiviral repsonse. HERC5 is physically assocated with polyribosomes and broadly modifies newly synthesized proteins in a cotranslational manner.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9UII4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51191
Name Human HERC5 (aa 640-735) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias CEB1; CEBP1; Cyclin-E-binding protein 1; E3 ISG15--protein ligase HERC5; HECT and RLD domain containing E3 ubiquitin protein ligase 5; HECT domain and RCC1-like domain-containing protein 5; hect domain and RLD 5; HERC5; probable E3 ubiquitin-protein ligase HERC5
Common Name HERC5
Gene Symbol HERC5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SKIKLLHTDTLLKIESKKHKAYLRSAAIEEERESEFALRPTFDLTVRRNHLIEDVLNQLSQFENEDLRKELWVSFSGEIGYDLGGVKKEFFYCLFA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.