Invitrogen™ Human HERC1 (aa 283-397) Control Fragment Recombinant Protein

Product Code. 30181359

Brand: Invitrogen™ RP98030

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62033 (PA5-62033. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gen encodes a member of the HERC protein family. This protein stimulates guanine nucleotide exchange on ARF1 and Rab proteins. This protein may be involved in membrane transport processes.

Specifications

• Accession Number: Q15751
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8925
• Name: Human HERC1 (aa 283-397) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: guanine nucleotide exchange factor p532; hect (homologous to the E6-AP (UBE3A) carboxyl terminus) domain and RCC1 (CHC1)-like domain (RLD) 1; HECT and RLD domain containing E3 ubiquitin protein ligase family member 1; HECT domain and RCC1-like domain-containing protein 1; HECT-type E3 ubiquitin transferase HERC1; HERC1; p532; p619; Probable E3 ubiquitin-protein ligase HERC1
• Common Name: HERC1
• Gene Symbol: HERC1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KGKLLSSQEGMISFDCFMTILMQMRRSLGSSADRSQWREPTRTSDGLCSLYEAALCLFEEVCRMASDYSRTCASPDSIQTGDAPIVSETCEVYVWGSNSSHQLVEGTQEKILQPK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining