Invitrogen™ Human Hepsin (aa 66-187) Control Fragment Recombinant Protein

Artikelnummer. 30201598

missing translation for 'mfr': Invitrogen™ RP89245

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82265 (PA5-82265. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Hepsin is a cell surface serine protease.

Spezifikation

• Accession Number: P05981
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 3249
• Name: Human Hepsin (aa 66-187) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: hepsin; hepsin (transmembrane protease, serine 1); Hlb320; HPN; Serine protease hepsin; Serine protease hepsin catalytic chain; Serine protease hepsin non-catalytic chain; testicular tissue protein Li 85; TMPRSS1; Transmembrane protease serine 1
• Common Name: Hepsin
• Gene Symbol: HPN
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCVDEGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLPVDRIVGGRDTSLGRWPWQVSLRYDGAHL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining