missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30207639

Invitrogen™ Human HEN2 (aa 3-67) Control Fragment Recombinant Protein

Product Code. 30207639
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30207639

Brand: Invitrogen™ RP101772

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63094 (PA5-63094. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May serve as DNA-binding protein and may be involved in the control of cell-type determination, possibly within the developing nervous system.
TRUSTED_SUSTAINABILITY

Specifikationer

Accession Number Q02577
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4808
Name Human HEN2 (aa 3-67) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 6230401I09Rik; bHLHa34; bHLHa35; class A basic helix-loop-helix protein 34; Class A basic helix-loop-helix protein 35; helix-loop-helix protein 1; HELIX-LOOP-HELIX PROTEIN 1 (HEN1) (NSCL); helix-loop-helix protein 2; HEN1; HEN-1; Hen2; HEN-2; KIAA0490; Nescient helix loop helix 1; nescient helix loop helix 2; nescient helix-loop-helix 1; nescient helix-loop-helix 2; Nhlh1; Nhlh2; Nscl; NSCL1; NSCL-1; NSCL2; NSCL-2; Tal2
Common Name HEN2
Gene Symbol NHLH2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LSPDQAADSDHPSSAHSDPESLGGTDTKVLGSVSDLEPVEEAEGDGKGGSRAALYPHPQQLSREE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.