Invitrogen™ Human HEMK1 (aa 237-326) Control Fragment Recombinant Protein

Product Code. 30209493

Brand: Invitrogen™ RP96312

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57023 (PA5-57023. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

N5-glutamine methyltransferase responsible for the methylation of the glutamine residue in the universally conserved GGQ motif of the mitochondrial translation release factor MTRF1L. [UniProt]

Specifications

• Accession Number: Q9Y5R4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51409
• Name: Human HEMK1 (aa 237-326) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2310008M14Rik; AW049265; HEMK; HEMK homolog 7 kb; hemK methyltransferase family member 1; HEMK1; M.HsaHemKP; MTQ1; MTRF1L release factor glutamine methyltransferase; RGD1308293; testis secretory sperm-binding protein Li 225 n
• Common Name: HEMK1
• Gene Symbol: HEMK1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VSNPPYVFHQDMEQLAPEIRSYEDPAALDGGEEGMDIITHILALAPRLLKDSGSIFLEVDPRHPELVSSWLQSRPDLYLNLVAVRRDFCG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining