Invitrogen™ Human HEMGN (aa 4-104) Control Fragment Recombinant Protein

Product Code. 30204272

Brand: Invitrogen™ RP92298

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (58%), Rat (58%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54037 (PA5-54037. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HEMGN regulates the proliferation and differentiation of hematopoietic cells. Overexpression of HEMGN block the TPA-induced megakaryocytic differentiation in the K562 cell model. HEMGN may also prevent cell apoptosis through the activation of the nuclear factor-kappa B (NF-kB).

Specifications

• Accession Number: Q9BXL5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55363
• Name: Human HEMGN (aa 4-104) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4921524M03Rik; AI317176; CT155; EDAG; EDAG-1; erythroid differentiation-associated gene protein; Hemgn; Hemogen; hemopoietic gene protein; Hgn; mNDR; NDR; negative differentiation regulator protein; nuclear protein; PRO1037; PRO1620; Unknown (protein for MGC:134079)
• Common Name: HEMGN
• Gene Symbol: HEMGN
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GKDQSHLKHHQTPDPHQEENHSPEVIGTWSLRNRELLRKRKAEVHEKETSQWLFGEQKKRKQQRTGKGNRRGRKRQQNTELKVEPQPQIEKEIVEKALAPI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining