missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human HEF1 (aa 43-137) Control Fragment Recombinant Protein

Product Code. 30205427
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30205427

Brand: Invitrogen™ RP102849

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111103 (PA5-111103. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HEF-1 is a multifunctional protein involved in integrin-based signaling that affects cell motility, growth, apoptosis and oncogenic transformation. The Cas family of docking proteins have been the subject of intense research because of their role in cell motility, growth, apoptosis and oncogenic transformation. These proteins are substrates of focal adhesion kinase (FAK) and the Src family of tyrosine kinases two active targets for drug development. HEF1 protein production increases levels of mRNA transcripts that encode proteins associated with motility, cell transformation and invasiveness, including several metalloproteinases, MLCK, p160ROCK and ErbBi. HEF1 overproduction also mediates apoptosis in epithelial-derived cell lines, including MCF7 and HeLa cells. Recent clinical studies at another institution have found that overexpression of BCAR1 (p130Cas), a related protein, is associated with tamoxifen resistance. This highlights the importance of studying the role of this family of proteins in cancer prognosis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q14511
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4739
Name Human HEF1 (aa 43-137) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Cas scaffolding protein family member 2; CAS2; CASL; CAS-L; cas-like docking; CASS2; Crk-associated substrate lymphocyte-specific protein; Crk-associated substrate related protein Cas-L; CRK-associated substrate-related protein; dJ49G10.2; dJ761I2.1; Enhancer of filamentation 1; Enhancer of filamentation 1 p55; HEF1; mEF1; Nedd9; NEDD-9; Neural precursor cell expressed developmentally down-regulated protein 9; neural precursor cell expressed, developmentally down-regulated 9; neural precursor cell expressed, developmentally down-regulated gene 9; p105; p130Cas-related protein; renal carcinoma antigen NY-REN-12
Common Name HEF1
Gene Symbol NEDD9
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence WWLCSLHGRQGIVPGNRVKLLIGPMQETASSHEQPASGLMQQTFGQQKLYQVPNPQAAPRDTIYQVPPSYQNQGIYQVPTGHGTQEQEVYQVPPS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.