Invitrogen™ Human HECTD4 (aa 3503-3605) Control Fragment Recombinant Protein

Product Code. 30181099

Brand: Invitrogen™ RP97827

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61010 (PA5-61010. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: Q9Y4D8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 283450
• Name: Human HECTD4 (aa 3503-3605) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A130010L24; AF-1 specific protein phosphatase; AU042671; BC019639; C12orf51; EG545802; Gm15800; HECT domain containing E3 ubiquitin protein ligase 4; HECT domain E3 ubiquitin protein ligase 4; HECT domain-containing protein 4; HECTD4; mKIAA0614; OTTMUSG00000026283; POTAGE; predicted gene 15800; probable E3 ubiquitin-protein ligase C12orf51; probable E3 ubiquitin-protein ligase HECTD4; transmembrane protein C12orf51
• Common Name: HECTD4
• Gene Symbol: HECTD4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ACLLNVPIESLRLRFALLQSLNTTLETFFLPLVELRQTPMYTHSIAALLKEAKGLIFYDTKVTVMNRVLNATVQRTADHAAPEITLDPLEIVGGEIRASENSY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining