Invitrogen™ Human HECTD2 (aa 78-150) Control Fragment Recombinant Protein

Product Code. 30195418

Brand: Invitrogen™ RP97141

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58096 (PA5-58096. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Probable E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.

Specifications

• Accession Number: Q5U5R9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 143279
• Name: Human HECTD2 (aa 78-150) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4921524L07; A630025O09Rik; AW212605; HECT domain containing 2; HECT domain containing E3 ubiquitin protein ligase 2; HECT domain E3 ubiquitin protein ligase 2; HECT domain-containing protein 2; Hectd2; HECT-type E3 ubiquitin transferase HECTD2; hmm77879; Probable E3 ubiquitin-protein ligase HECTD2
• Common Name: HECTD2
• Gene Symbol: Hectd2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SPAHLVFPNIKNVREPPPICLDVRQKQRTSMDASSSEMKAPVLPEPILPIQPKTVKDFQEDVEKVKSSGDWKA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining