missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30198853

Invitrogen™ Human HEC1 (aa 232-311) Control Fragment Recombinant Protein

Product Code. 30198853
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30198853

Brand: Invitrogen™ RP105391

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111613 (PA5-111613. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Hec1 is one of several proteins involved in spindle checkpoint signaling. This surveillance mechanism assures correct segregation of chromosomes during cell division by detecting unaligned chromosomes and causing prometaphase arrest until the proper bipolar attachment of chromosomes is achieved.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O14777
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10403
Name Human HEC1 (aa 232-311) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2610020P18Rik; AV139730; HEC; HEC1; HEC-1; HEC2; HEC4; Highly expressed in cancer protein; highly expressed in cancer, rich in leucine heptad repeats; HsHec1; hsNDC80; kinetochore associated 2; kinetochore protein Hec1; Kinetochore protein NDC80 homolog; kinetochore-associated protein 2; KNTC2; NDC80; NDC80 homolog, kinetochore complex component; NDC80 homolog, kinetochore complex component (S. cerevisiae); NDC80 kinetochore complex component; NDC80 kinetochore complex component homolog; NDC80, kinetochore complex component; putative kinetochore protein NDC80 like protein; retinoblastoma-associated protein HEC; TID3
Common Name HEC1
Gene Symbol NDC80
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence CYESFMSGADSFDEMNAELQSKLKDLFNVDAFKLESLEAKNRALNEQIARLEQEREKEPNRLESLRKLKASLQGDVQKYQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.